Lineage for d5jjnc_ (5jjn C:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225116Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2225215Protein Sensory rhodopsin II [64526] (1 species)
  7. 2225216Species Natronobacterium pharaonis [TaxId:2257] [64527] (14 PDB entries)
  8. 2286523Domain d5jjnc_: 5jjn C: [329824]
    automated match to d1h2sa_
    complexed with bog, lfa, ret

Details for d5jjnc_

PDB Entry: 5jjn (more details), 2.25 Å

PDB Description: structure of the srii/htrii(g83f) complex in p212121 space group ("v" shape)
PDB Compounds: (C:) Sensory rhodopsin-2

SCOPe Domain Sequences for d5jjnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jjnc_ f.13.1.1 (C:) Sensory rhodopsin II {Natronobacterium pharaonis [TaxId: 2257]}
glttlfwlgaigmlvgtlafawagrdagsgerryyvtlvgisgiaavayvvmalgvgwvp
vaertvfapryidwilttplivyflgllagldsrefgivitlntvvmlagfagamvpgie
ryalfgmgavaflglvyylvgpmtesasqrssgikslyvrlrnltvilwaiypfiwllgp
pgvalltptvdvalivyldlvtkvgfgfialdaaa

SCOPe Domain Coordinates for d5jjnc_:

Click to download the PDB-style file with coordinates for d5jjnc_.
(The format of our PDB-style files is described here.)

Timeline for d5jjnc_:

  • d5jjnc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16