Lineage for d5mt4a_ (5mt4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057530Species Human (Homo sapiens) [TaxId:9606] [187233] (145 PDB entries)
  8. 2286522Domain d5mt4a_: 5mt4 A: [329823]
    automated match to d1op8a_
    complexed with m7o

Details for d5mt4a_

PDB Entry: 5mt4 (more details), 1.65 Å

PDB Description: complement factor d in complex with a reversible benzoic acid based inhibitor
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d5mt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mt4a_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d5mt4a_:

Click to download the PDB-style file with coordinates for d5mt4a_.
(The format of our PDB-style files is described here.)

Timeline for d5mt4a_:

  • d5mt4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15