Lineage for d5mhrh2 (5mhr H:108-210)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2354557Domain d5mhrh2: 5mhr H:108-210 [329822]
    Other proteins in same PDB: d5mhrg1, d5mhrh1, d5mhrj1, d5mhrl1, d5mhro1, d5mhrq1
    automated match to d1tqbc2

Details for d5mhrh2

PDB Entry: 5mhr (more details), 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments
PDB Compounds: (H:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhrh2:

Sequence, based on SEQRES records: (download)

>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records): (download)

>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdkwkidgseqngvlnswtdqdskds
tysmsstltltkdeyerhnsytceathkstspivksfn

SCOPe Domain Coordinates for d5mhrh2:

Click to download the PDB-style file with coordinates for d5mhrh2.
(The format of our PDB-style files is described here.)

Timeline for d5mhrh2: