SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mhrh2 (5mhr H:108-210)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2286521Domain d5mhrh2: 5mhr H:108-210 [329822]
    Other proteins in same PDB: d5mhrg1, d5mhrh1, d5mhrj1, d5mhrl1, d5mhro1, d5mhrq1
    automated match to d1tqbc2

Details for d5mhrh2

PDB Entry: 5mhr (more details), 3 Å

PDB Description: t3d reovirus sigma1 complexed with 9bg5 fab fragments
PDB Compounds: (H:) 9BG5 Fab light chain,LOC100046793 protein,MAb 110 light chain

SCOPe Domain Sequences for d5mhrh2:

Sequence, based on SEQRES records: (download)

>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Sequence, based on observed residues (ATOM records): (download)

>d5mhrh2 b.1.1.2 (H:108-210) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdkwkidgseqngvlnswtdqdskds
tysmsstltltkdeyerhnsytceathkstspivksfn

SCOPe Domain Coordinates for d5mhrh2:

Click to download the PDB-style file with coordinates for d5mhrh2.
(The format of our PDB-style files is described here.)

Timeline for d5mhrh2:

  • d5mhrh2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16