Lineage for d5lgza_ (5lgz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080344Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 2080345Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries)
    Uniprot P71278
  8. 2286516Domain d5lgza_: 5lgz A: [329817]
    automated match to d1gvra_
    complexed with fnr, ipa

Details for d5lgza_

PDB Entry: 5lgz (more details), 1.5 Å

PDB Description: structure of photoreduced pentaerythritol tetranitrate reductase
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d5lgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lgza_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl

SCOPe Domain Coordinates for d5lgza_:

Click to download the PDB-style file with coordinates for d5lgza_.
(The format of our PDB-style files is described here.)

Timeline for d5lgza_:

  • d5lgza_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15