SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lgza_ (5lgz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080344Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 2080345Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries)
    Uniprot P71278
  8. 2286516Domain d5lgza_: 5lgz A: [329817]
    automated match to d1gvra_
    complexed with fnr, ipa

Details for d5lgza_

PDB Entry: 5lgz (more details), 1.5 Å

PDB Description: structure of photoreduced pentaerythritol tetranitrate reductase
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d5lgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lgza_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl

SCOPe Domain Coordinates for d5lgza_:

Click to download the PDB-style file with coordinates for d5lgza_.
(The format of our PDB-style files is described here.)

Timeline for d5lgza_:

  • d5lgza_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15