SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m2fx_ (5m2f X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2080974Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2080975Species Human (Homo sapiens) [TaxId:9606] [51437] (135 PDB entries)
    Uniprot P15121
  8. 2286515Domain d5m2fx_: 5m2f X: [329816]
    automated match to d4xzlx_
    complexed with edo, nap, uv8

Details for d5m2fx_

PDB Entry: 5m2f (more details), 1.5 Å

PDB Description: crystal structure of human akr1b10 complexed with nadp+ and the synthetic retinoid uvi2008
PDB Compounds: (X:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d5m2fx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2fx_ c.1.7.1 (X:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
dlfprddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
llqsshledypfnaey

SCOPe Domain Coordinates for d5m2fx_:

Click to download the PDB-style file with coordinates for d5m2fx_.
(The format of our PDB-style files is described here.)

Timeline for d5m2fx_:

  • d5m2fx_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15