SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gsub_ (5gsu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986832Protein Histone H4 [47125] (7 species)
  7. 1986833Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (52 PDB entries)
  8. 2286514Domain d5gsub_: 5gsu B: [329815]
    Other proteins in same PDB: d5gsuc_, d5gsud_, d5gsug_, d5gsuh_
    automated match to d1kx3f_
    protein/DNA complex; complexed with cl, mn

Details for d5gsub_

PDB Entry: 5gsu (more details), 3.1 Å

PDB Description: crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5gsub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gsub_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5gsub_:

Click to download the PDB-style file with coordinates for d5gsub_.
(The format of our PDB-style files is described here.)

Timeline for d5gsub_:

  • d5gsub_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16