SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i02a_ (5i02 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089569Species Zymomonas mobilis [TaxId:264203] [224878] (22 PDB entries)
  8. 2286513Domain d5i02a_: 5i02 A: [329814]
    automated match to d4jbra_
    protein/RNA complex; complexed with cl, edo, gol, pk2, zn

Details for d5i02a_

PDB Entry: 5i02 (more details), 1.25 Å

PDB Description: trna guanine transglycosylase (tgt) in co-crystallized complex with 6- amino-4-{2-[(cyclohexylmethyl)amino]ethyl}-2-(methylamino)-1,7- dihydro-8h-imidazo[4,5-g]quinazolin-8-one
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d5i02a_:

Sequence, based on SEQRES records: (download)

>d5i02a_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 264203]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
fsqfaqdfraryfarn

Sequence, based on observed residues (ATOM records): (download)

>d5i02a_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 264203]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaagadiilgntyhlmlrpgaer
iaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkhmlspersieiqhllgs
divmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalfgiqqgsvfen
lrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphylmgvgkpddiv
gavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsechcavcqkwsra
yihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfraryfarn

SCOPe Domain Coordinates for d5i02a_:

Click to download the PDB-style file with coordinates for d5i02a_.
(The format of our PDB-style files is described here.)

Timeline for d5i02a_:

  • d5i02a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15