Lineage for d5knlc1 (5knl C:1-167)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508192Species Schizosaccharomyces pombe [TaxId:284812] [329787] (1 PDB entry)
  8. 2508193Domain d5knlc1: 5knl C:1-167 [329812]
    Other proteins in same PDB: d5knlb_, d5knlc2, d5knle_, d5knlf2
    automated match to d2ucza_
    complexed with so4

Details for d5knlc1

PDB Entry: 5knl (more details), 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 15

SCOPe Domain Sequences for d5knlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5knlc1 d.20.1.0 (C:1-167) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mpssaseqllrkqlkeiqknppqgfsvglvddksifewevmiigpedtlyeggffhatls
fpqdyplmppkmkftteiwhpnvhpngevcisilhppgddkygyedagerwlpvhspeti
lisvismlsspndespanidaakefrenpqefkkrvrrlvrrsiemi

SCOPe Domain Coordinates for d5knlc1:

Click to download the PDB-style file with coordinates for d5knlc1.
(The format of our PDB-style files is described here.)

Timeline for d5knlc1: