Lineage for d5lcfa_ (5lcf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555488Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2555639Protein automated matches [190079] (9 species)
    not a true protein
  7. 2555692Species Pseudomonas aeruginosa [TaxId:287] [189349] (41 PDB entries)
  8. 2555736Domain d5lcfa_: 5lcf A: [329806]
    automated match to d5a87b_
    complexed with 6tj, gol, mg, zn

Details for d5lcfa_

PDB Entry: 5lcf (more details), 1.86 Å

PDB Description: vim-2 metallo-beta-lactamase in complex with 3-oxo-2- phenylisoindoline-4-carboxylic acid (compound 30)
PDB Compounds: (A:) Metallo-beta-lactamase VIM-2

SCOPe Domain Sequences for d5lcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lcfa_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakntaallae
iekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneipthslegl
sssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnvadadlae
wptsieriqqhypeaqfvipghglpggldllkhttnvvkaht

SCOPe Domain Coordinates for d5lcfa_:

Click to download the PDB-style file with coordinates for d5lcfa_.
(The format of our PDB-style files is described here.)

Timeline for d5lcfa_: