Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (30 PDB entries) Uniprot P08263 |
Domain d1gumd2: 1gum D:4-80 [32980] Other proteins in same PDB: d1guma1, d1gumb1, d1gumc1, d1gumd1, d1gume1, d1gumf1, d1gumg1, d1gumh1 |
PDB Entry: 1gum (more details), 3 Å
SCOPe Domain Sequences for d1gumd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gumd2 c.47.1.5 (D:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm klvqtrsilhyiadkhn
Timeline for d1gumd2: