SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kkka_ (5kkk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978220Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (263 PDB entries)
    Uniprot P02185
  8. 2286494Domain d5kkka_: 5kkk A: [329795]
    automated match to d1jw8a_
    complexed with cl, cmo, hem, so4

Details for d5kkka_

PDB Entry: 5kkk (more details), 1.7 Å

PDB Description: 1.7-angstrom in situ mylar structure of sperm whale myoglobin (swmb- co) at 100 k
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5kkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kkka_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5kkka_:

Click to download the PDB-style file with coordinates for d5kkka_.
(The format of our PDB-style files is described here.)

Timeline for d5kkka_:

  • d5kkka_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15