SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g1za1 (5g1z A:26-210)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (37 species)
    not a true protein
  7. 2188225Species Plasmodium vivax [TaxId:5855] [234134] (12 PDB entries)
  8. 2286493Domain d5g1za1: 5g1z A:26-210 [329794]
    automated match to d1iica1
    complexed with cl, dms, mg, nhw, so4, u53

Details for d5g1za1

PDB Entry: 5g1z (more details), 1.5 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 1)
PDB Compounds: (A:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1za1 d.108.1.0 (A:26-210) automated matches {Plasmodium vivax [TaxId: 5855]}
idykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrs
eiytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaip
tdicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkp
vsdar

SCOPe Domain Coordinates for d5g1za1:

Click to download the PDB-style file with coordinates for d5g1za1.
(The format of our PDB-style files is described here.)

Timeline for d5g1za1:

  • d5g1za1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15