SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fv4a_ (5fv4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2286403Species Sus scrofa [TaxId:9823] [329704] (1 PDB entry)
  8. 2286492Domain d5fv4a_: 5fv4 A: [329793]
    automated match to d1k4ya_

Details for d5fv4a_

PDB Entry: 5fv4 (more details), 2.4 Å

PDB Description: pig liver esterase 5 (ple5)
PDB Compounds: (A:) Carboxylic ester hydrolase

SCOPe Domain Sequences for d5fv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fv4a_ c.69.1.1 (A:) automated matches {Sus scrofa [TaxId: 9823]}
sppvvdtaqgrvlgkyvsleglaqpvavflgvpfakpplgslrfappqpaepwsfvkntt
syppmccqdpvagqmtsdlftnrkerlipefsedclylniytpadltkrgrlpvmvwihg
gglvvggastydglalaahenvvvvaiqyrlgiwgffstgdehsrgnwghldqvaalhwv
qenianfggdpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaftaglvrkdmk
aaakqiavlagcktttsavfvhclrqksedelldltlkmkffaldlhgdpreshpflttv
vdgvllpkmpeeilaekdfntvpyivginkqefgwllptmmgfplsegkldqktatsllw
ksypianipeeltpvatdkylggtddpvkkkdlfldlmgdvvfgvpsvtvarqhrdagap
tymyefqyrpsfssdkkpktvigdhgdeifsvfgapflrgdapeeevslsktvmkfwanf
arsgnpngeglphwpmydqeegylqigvntqaakrlkgeevafwndllsk

SCOPe Domain Coordinates for d5fv4a_:

Click to download the PDB-style file with coordinates for d5fv4a_.
(The format of our PDB-style files is described here.)

Timeline for d5fv4a_:

  • d5fv4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-16