SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5knlf1 (5knl F:1-167)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164520Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2164521Protein automated matches [190120] (8 species)
    not a true protein
  7. 2286486Species Schizosaccharomyces pombe [TaxId:284812] [329787] (1 PDB entry)
  8. 2286487Domain d5knlf1: 5knl F:1-167 [329788]
    Other proteins in same PDB: d5knlb_, d5knlc2, d5knle_, d5knlf2
    automated match to d2ucza_
    complexed with so4

Details for d5knlf1

PDB Entry: 5knl (more details), 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin
PDB Compounds: (F:) Ubiquitin-conjugating enzyme E2 15

SCOPe Domain Sequences for d5knlf1:

Sequence, based on SEQRES records: (download)

>d5knlf1 d.20.1.0 (F:1-167) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mpssaseqllrkqlkeiqknppqgfsvglvddksifewevmiigpedtlyeggffhatls
fpqdyplmppkmkftteiwhpnvhpngevcisilhppgddkygyedagerwlpvhspeti
lisvismlsspndespanidaakefrenpqefkkrvrrlvrrsiemi

Sequence, based on observed residues (ATOM records): (download)

>d5knlf1 d.20.1.0 (F:1-167) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mpssaseqllrkqlkeiqknppqgfsvglvddksifewevmiigpedtlyeggffhatls
fpqdyplmppkmkftteiwhpnvhpngevcisilhppgderwlpvhspetilisvismls
spndespanidaakefrenpqefkkrvrrlvrrsiemi

SCOPe Domain Coordinates for d5knlf1:

Click to download the PDB-style file with coordinates for d5knlf1.
(The format of our PDB-style files is described here.)

Timeline for d5knlf1:

  • d5knlf1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16