SCOPe 2.06: Domain d5gsug_: 5gsu G:

Lineage for d5gsug_ (5gsu G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225310] (17 PDB entries)

8. Domain d5gsug_: 5gsu G: [329786]
   Other proteins in same PDB: d5gsub_, d5gsuf_
   automated match to d2pyoc_
   protein/DNA complex; complexed with cl, mn

Details for d5gsug_

PDB Entry: 5gsu, 3.1 Å

PDB Description: crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b

PDB Compounds: (G:) Histone H2A type 1-A

SCOPe Domain Sequences for d5gsug_:

Sequence; same for both SEQRES and ATOM records:

>d5gsug_ a.22.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sksrssraglqfpvgrihrllrkgnyaerigagapvylaavleyltaeilelagnasrdn
kktriiprhlqlairndeelnkllggvtiaqggvlpniqavllpk

Timeline for d5gsug_:

• d5gsug_ is new in SCOPe 2.06-stable
  
• d5gsug_ appears in SCOPe 2.07
  
• d5gsug_ appears in the current release, SCOPe 2.08