Lineage for d5invb2 (5inv B:275-460)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107283Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 protein domains)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2107284Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2107285Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69464] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2286484Domain d5invb2: 5inv B:275-460 [329785]
    Other proteins in same PDB: d5inva1, d5invb1
    automated match to d1n0ha1
    complexed with bct, co2, fad, htl, k, mg, oxy, po4, tpp

Details for d5invb2

PDB Entry: 5inv (more details), 2.28 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5invb2:

Sequence, based on SEQRES records: (download)

>d5invb2 c.31.1.3 (B:275-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvttt
lqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearr
aaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkw
kkeypy

Sequence, based on observed residues (ATOM records): (download)

>d5invb2 c.31.1.3 (B:275-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qltsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvttt
lqglgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearr
aaaegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqieyp
y

SCOPe Domain Coordinates for d5invb2:

Click to download the PDB-style file with coordinates for d5invb2.
(The format of our PDB-style files is described here.)

Timeline for d5invb2:

  • d5invb2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-16

View in 3D
Domains from same chain:
(mouse over for more information)
d5invb1