SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5knlb_ (5knl B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158943Protein automated matches [190118] (10 species)
    not a true protein
  7. 2286478Species Pseudozyma antarctica [TaxId:84753] [329779] (1 PDB entry)
  8. 2286482Domain d5knlb_: 5knl B: [329783]
    Other proteins in same PDB: d5knlc1, d5knlc2, d5knlf1, d5knlf2
    automated match to d3wwqa_
    complexed with so4

Details for d5knlb_

PDB Entry: 5knl (more details), 2.5 Å

PDB Description: crystal structure of s. pombe ubiquitin e1 (uba1) in complex with ubc15 and ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d5knlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5knlb_ d.15.1.1 (B:) automated matches {Pseudozyma antarctica [TaxId: 84753]}
mqifvrtltgrtitlevessdtidnvrariqdregippdqqrlifagrqledgrtladyn
iqrestlhlvlrlrgg

SCOPe Domain Coordinates for d5knlb_:

Click to download the PDB-style file with coordinates for d5knlb_.
(The format of our PDB-style files is described here.)

Timeline for d5knlb_:

  • d5knlb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15