Lineage for d5grla_ (5grl A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479856Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2479857Protein automated matches [190603] (17 species)
    not a true protein
  7. 2479904Species Human (Homo sapiens) [TaxId:9606] [329721] (6 PDB entries)
  8. 2479911Domain d5grla_: 5grl A: [329778]
    automated match to d3blxo_
    complexed with adp, ict, mg

Details for d5grla_

PDB Entry: 5grl (more details), 2.79 Å

PDB Description: crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), isocitrate and adp
PDB Compounds: (A:) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial

SCOPe Domain Sequences for d5grla_:

Sequence, based on SEQRES records: (download)

>d5grla_ c.77.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqgpggkwmipseakesmdk
nkmglkgplktpiaaghpsmnlllrktfdlyanvrpcvsiegyktpytdvnivtirente
geysgiehvivdgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrmsdgl
flqkcrevaesckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagliggl
gvtpsgnigangvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaarieaa
cfatikdgksltkdlggnakcsdfteeicrrvkdl

Sequence, based on observed residues (ATOM records): (download)

>d5grla_ c.77.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtvtlipgdgigpeisaavmkifdaakapiqweernvtaiqwmipseakesmdknkmgl
kgplktpsmnlllrktfdlyanvrpcvsiegyktpytdvnivtirentegeysgiehviv
dgvvqsiklitegaskriaefafeyarnnhrsnvtavhkanimrmsdglflqkcrevaes
ckdikfnemyldtvclnmvqdpsqfdvlvmpnlygdilsdlcagligglgvtpsgnigan
gvaifesvhgtapdiagkdmanptalllsavmmlrhmglfdhaarieaacfatikdgksl
tkdggnakcsdfteeicrrvkdl

SCOPe Domain Coordinates for d5grla_:

Click to download the PDB-style file with coordinates for d5grla_.
(The format of our PDB-style files is described here.)

Timeline for d5grla_: