SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1mf_ (5b1m F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1987109Species Mouse (Mus musculus) [TaxId:10090] [254907] (3 PDB entries)
  8. 2286465Domain d5b1mf_: 5b1m F: [329766]
    automated match to d1kx3f_
    protein/DNA complex

Details for d5b1mf_

PDB Entry: 5b1m (more details), 2.34 Å

PDB Description: the mouse nucleosome structure containing h3.1
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d5b1mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1mf_ a.22.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5b1mf_:

Click to download the PDB-style file with coordinates for d5b1mf_.
(The format of our PDB-style files is described here.)

Timeline for d5b1mf_:

  • d5b1mf_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15