SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jgra_ (5jgr A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2154375Protein automated matches [193860] (2 species)
    not a true protein
  7. 2279693Species Enterobacteria phage [TaxId:348604] [322994] (7 PDB entries)
  8. 2286462Domain d5jgra_: 5jgr A: [329763]
    automated match to d212la_
    complexed with cl, hez, k, po4, v1a

Details for d5jgra_

PDB Entry: 5jgr (more details), 1.46 Å

PDB Description: spin-labeled t4 lysozyme construct k43v1
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d5jgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jgra_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 348604]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaacseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d5jgra_:

Click to download the PDB-style file with coordinates for d5jgra_.
(The format of our PDB-style files is described here.)

Timeline for d5jgra_:

  • d5jgra_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15