SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hxfa1 (5hxf A:2-182)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2270184Species Enterovirus a71 [TaxId:39054] [313489] (2 PDB entries)
  8. 2286460Domain d5hxfa1: 5hxf A:2-182 [329761]
    Other proteins in same PDB: d5hxfa2
    automated match to d2vb0a_
    complexed with ag7, so4

Details for d5hxfa1

PDB Entry: 5hxf (more details), 1.39 Å

PDB Description: crystal structure of 3c protease from a mild human enterovirus 71 in complex with rupintrivir
PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d5hxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hxfa1 b.47.1.0 (A:2-182) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwvehklvnvldav
elvdeqgvdleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvvgihiggngrqgfcaglkrsyfa
s

SCOPe Domain Coordinates for d5hxfa1:

Click to download the PDB-style file with coordinates for d5hxfa1.
(The format of our PDB-style files is described here.)

Timeline for d5hxfa1:

  • d5hxfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5hxfa2