SCOPe 2.06: Domain d5inva1: 5inv A:83-270

Lineage for d5inva1 (5inv A:83-270)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (10 PDB entries)
   Uniprot P07342 84-687

8. Domain d5inva1: 5inv A:83-270 [329757]
   Other proteins in same PDB: d5inva2, d5invb2
   automated match to d1n0ha2
   complexed with bct, co2, fad, htl, k, mg, oxy, po4, tpp

Details for d5inva1

PDB Entry: 5inv, 2.28 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase

PDB Compounds: (A:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5inva1:

Sequence; same for both SEQRES and ATOM records:

>d5inva1 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

Timeline for d5inva1:

• d5inva1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15
  
• d5inva1 became obsolete in SCOPe 2.07