SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5inva1 (5inv A:83-270)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108260Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 protein domains)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2108261Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2108262Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (8 PDB entries)
    Uniprot P07342 84-687
  8. 2286456Domain d5inva1: 5inv A:83-270 [329757]
    Other proteins in same PDB: d5inva2, d5invb2
    automated match to d1n0ha2
    complexed with bct, co2, fad, htl, k, mg, oxy, po4, tpp

Details for d5inva1

PDB Entry: 5inv (more details), 2.28 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase
PDB Compounds: (A:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5inva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5inva1 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

SCOPe Domain Coordinates for d5inva1:

Click to download the PDB-style file with coordinates for d5inva1.
(The format of our PDB-style files is described here.)

Timeline for d5inva1:

  • d5inva1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5inva2