Lineage for d5i51a3 (5i51 A:532-677)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120181Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2120182Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2120348Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2120349Protein automated matches [226991] (9 species)
    not a true protein
  7. 2285550Species Scheffersomyces stipitis [TaxId:322104] [328851] (7 PDB entries)
  8. 2286452Domain d5i51a3: 5i51 A:532-677 [329753]
    Other proteins in same PDB: d5i51a1, d5i51a2
    automated match to d1gpua3
    complexed with ca, f6r, peg, tpp; mutant

Details for d5i51a3

PDB Entry: 5i51 (more details), 1.54 Å

PDB Description: crystal structure of transketolase mutant-r356l complex with fructose- 6-phoaphate from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5i51a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i51a3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5i51a3:

Click to download the PDB-style file with coordinates for d5i51a3.
(The format of our PDB-style files is described here.)

Timeline for d5i51a3:

  • d5i51a3 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15