SCOPe 2.05: Domain d1gulg2: 1gul G:4-80

Lineage for d1gulg2 (1gul G:4-80)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
   Uniprot P08263

8. Domain d1gulg2: 1gul G:4-80 [32975]
   Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1

Details for d1gulg2

PDB Entry: 1gul, 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

PDB Compounds: (G:) glutathione transferase a4-4

SCOPe Domain Sequences for d1gulg2:

Sequence; same for both SEQRES and ATOM records:

>d1gulg2 c.47.1.5 (G:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

Timeline for d1gulg2:

• d1gulg2 first appeared (with stable ids) in SCOP 1.55
  
• d1gulg2 appears in SCOPe 2.04
  
• d1gulg2 appears in SCOPe 2.06
  
• d1gulg2 appears in the current release, SCOPe 2.08