Lineage for d1gulg2 (1gul G:4-80)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181030Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 181045Domain d1gulg2: 1gul G:4-80 [32975]
    Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1

Details for d1gulg2

PDB Entry: 1gul (more details), 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1gulg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gulg2 c.47.1.5 (G:4-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOP Domain Coordinates for d1gulg2:

Click to download the PDB-style file with coordinates for d1gulg2.
(The format of our PDB-style files is described here.)

Timeline for d1gulg2: