Lineage for d5b3cb1 (5b3c B:2-109)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (877 PDB entries)
  8. 2286444Domain d5b3cb1: 5b3c B:2-109 [329745]
    Other proteins in same PDB: d5b3ca2, d5b3cb2, d5b3cc2, d5b3cd2, d5b3ce2, d5b3cf2, d5b3cg2, d5b3ch2
    automated match to d4v1db_
    mutant

Details for d5b3cb1

PDB Entry: 5b3c (more details), 2.88 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain
PDB Compounds: (B:) Ig kappa chain V-I region Rei

SCOPe Domain Sequences for d5b3cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3cb1 b.1.1.0 (B:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr

SCOPe Domain Coordinates for d5b3cb1:

Click to download the PDB-style file with coordinates for d5b3cb1.
(The format of our PDB-style files is described here.)

Timeline for d5b3cb1:

  • d5b3cb1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15