Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d5b3cb1: 5b3c B:2-109 [329745] Other proteins in same PDB: d5b3ca2, d5b3cb2, d5b3cc2, d5b3cd2, d5b3ce2, d5b3cf2, d5b3cg2, d5b3ch2 automated match to d4v1db_ mutant |
PDB Entry: 5b3c (more details), 2.88 Å
SCOPe Domain Sequences for d5b3cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3cb1 b.1.1.0 (B:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps rfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr
Timeline for d5b3cb1: