SCOPe 2.06: Domain d5b3ch1: 5b3c H:2-109

Lineage for d5b3ch1 (5b3c H:2-109)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (28 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
Domain d5b3ch1: 5b3c H:2-109 [329737]
Other proteins in same PDB: d5b3ca2, d5b3cb2, d5b3cc2, d5b3cd2, d5b3ce2, d5b3cf2, d5b3cg2, d5b3ch2
automated match to d4v1db_
mutant

Details for d5b3ch1

PDB Entry: 5b3c (more details), 2.88 Å

PDB Description: structure of monomeric mutant of rei immunoglobulin light chain variable domain

PDB Compounds: (H:) Ig kappa chain V-I region Rei

SCOPe Domain Sequences for d5b3ch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3ch1 b.1.1.0 (H:2-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
rfsgsgsgtdytftisslqpediatyycqqyqslpktfgqgtklqitr

SCOPe Domain Coordinates for d5b3ch1:

Click to download the PDB-style file with coordinates for d5b3ch1.
(The format of our PDB-style files is described here.)

Timeline for d5b3ch1: