Lineage for d5gsuh_ (5gsu H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 2310745Protein automated matches [193445] (6 species)
    not a true protein
  7. 2310800Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries)
  8. 2310990Domain d5gsuh_: 5gsu H: [329714]
    Other proteins in same PDB: d5gsub_, d5gsuf_
    automated match to d3afad_
    protein/DNA complex; complexed with cl, mn

Details for d5gsuh_

PDB Entry: 5gsu (more details), 3.1 Å

PDB Description: crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
PDB Compounds: (H:) Histone H2B type 1-A

SCOPe Domain Sequences for d5gsuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gsuh_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trkesysiyiykvlkqvhpdtgisskamsimnsfvtdiferiaseasrlahyskrstiss
reiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d5gsuh_:

Click to download the PDB-style file with coordinates for d5gsuh_.
(The format of our PDB-style files is described here.)

Timeline for d5gsuh_: