SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gsuh_ (5gsu H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986516Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1986517Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1986518Family a.22.1.1: Nucleosome core histones [47114] (6 protein domains)
    form octamers composed of two copies of each of the four histones
  6. 1986958Protein automated matches [193445] (6 species)
    not a true protein
  7. 1986993Species Human (Homo sapiens) [TaxId:9606] [193446] (44 PDB entries)
  8. 2286413Domain d5gsuh_: 5gsu H: [329714]
    Other proteins in same PDB: d5gsub_, d5gsuf_
    automated match to d3afad_
    protein/DNA complex; complexed with cl, mn

Details for d5gsuh_

PDB Entry: 5gsu (more details), 3.1 Å

PDB Description: crystal structure of nucleosome core particle consisting of human testis-specific histone variants, th2a and th2b
PDB Compounds: (H:) Histone H2B type 1-A

SCOPe Domain Sequences for d5gsuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gsuh_ a.22.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trkesysiyiykvlkqvhpdtgisskamsimnsfvtdiferiaseasrlahyskrstiss
reiqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d5gsuh_:

Click to download the PDB-style file with coordinates for d5gsuh_.
(The format of our PDB-style files is described here.)

Timeline for d5gsuh_:

  • d5gsuh_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15