SCOPe 2.06: Domain d5b1mb_: 5b1m B:

Lineage for d5b1mb_ (5b1m B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [254907] (3 PDB entries)

8. Domain d5b1mb_: 5b1m B: [329713]
   automated match to d1kx3f_
   protein/DNA complex

Details for d5b1mb_

PDB Entry: 5b1m, 2.34 Å

PDB Description: the mouse nucleosome structure containing h3.1

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5b1mb_:

Sequence; same for both SEQRES and ATOM records:

>d5b1mb_ a.22.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg

Timeline for d5b1mb_:

• d5b1mb_ is new in SCOPe 2.06-stable
  
• d5b1mb_ appears in SCOPe 2.07
  
• d5b1mb_ appears in the current release, SCOPe 2.08