Lineage for d5g22c1 (5g22 C:27-210)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (42 species)
    not a true protein
  7. 2188225Species Plasmodium vivax [TaxId:5855] [234134] (12 PDB entries)
  8. 2286409Domain d5g22c1: 5g22 C:27-210 [329710]
    automated match to d1iica1
    complexed with cl, mg, nhw, so4, yn4

Details for d5g22c1

PDB Entry: 5g22 (more details), 2.32 Å

PDB Description: plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 26)
PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase

SCOPe Domain Sequences for d5g22c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g22c1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]}
dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse
iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt
dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv
sdar

SCOPe Domain Coordinates for d5g22c1:

Click to download the PDB-style file with coordinates for d5g22c1.
(The format of our PDB-style files is described here.)

Timeline for d5g22c1:

  • d5g22c1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-15