SCOP 1.57: Domain d1gulc2: 1gul C:4-80

Lineage for d1gulc2 (1gul C:4-80)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)

8. Domain d1gulc2: 1gul C:4-80 [32971]
   Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1

Details for d1gulc2

PDB Entry: 1gul, 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione

SCOP Domain Sequences for d1gulc2:

Sequence; same for both SEQRES and ATOM records:

>d1gulc2 c.47.1.5 (C:4-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

Timeline for d1gulc2:

• d1gulc2 first appeared (with stable ids) in SCOP 1.55
  
• d1gulc2 appears in SCOP 1.59
  
• d1gulc2 appears in the current release, SCOPe 2.08