Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [254907] (3 PDB entries) |
Domain d5b1lg_: 5b1l G: [329702] automated match to d2pyoc_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5b1l (more details), 2.35 Å
SCOPe Domain Sequences for d5b1lg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1lg_ a.22.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d5b1lg_: