SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b3ra_ (5b3r A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205890Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)
  8. 2286396Domain d5b3ra_: 5b3r A: [329697]
    automated match to d4uama_
    complexed with cit, zn

Details for d5b3ra_

PDB Entry: 5b3r (more details), 2 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-18 from pseudomonas aeruginosa
PDB Compounds: (A:) imp-18

SCOPe Domain Sequences for d5b3ra_:

Sequence, based on SEQRES records: (download)

>d5b3ra_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lpdlkieklekgvyvhtsfeevkgwgvvtkhglvvlvkndaylidtpitakdteklvnwf
iehgyrikgsisthfhgdstagiewlnsqsistyaseltnellkkdnkvqatnsfsgvsy
sliknkievfypgpghtqdnvvvwlpekkilfggcfvkpdglgnlgdanleawpksakil
mskygkaklvvsshseignasllqrtweqavkglnes

Sequence, based on observed residues (ATOM records): (download)

>d5b3ra_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lpdlkieklekgvyvhtsfegwgvvtkhglvvlvkndaylidtpitakdteklvnwfieh
gyrikgsisthfhgdstagiewlnsqsistyaseltnellkkdnkvqatnsfsgvsysli
knkievfypgpghtqdnvvvwlpekkilfggcfvkpdglgnlgdanleawpksakilmsk
ygkaklvvsshseignasllqrtweqavkglnes

SCOPe Domain Coordinates for d5b3ra_:

Click to download the PDB-style file with coordinates for d5b3ra_.
(The format of our PDB-style files is described here.)

Timeline for d5b3ra_:

  • d5b3ra_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-15