Lineage for d5u6qb2 (5u6q B:111-200)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361045Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2361050Domain d5u6qb2: 5u6q B:111-200 [329696]
    Other proteins in same PDB: d5u6qa1, d5u6qa2, d5u6qa3, d5u6qb1, d5u6qc1, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_
    automated match to d2f54d2
    complexed with 7zs, act, gol, na

Details for d5u6qb2

PDB Entry: 5u6q (more details), 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr
PDB Compounds: (B:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u6qb2:

Sequence, based on SEQRES records: (download)

>d5u6qb2 b.1.1.2 (B:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d5u6qb2 b.1.1.2 (B:111-200) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
snksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5u6qb2:

Click to download the PDB-style file with coordinates for d5u6qb2.
(The format of our PDB-style files is described here.)

Timeline for d5u6qb2: