SCOPe 2.07: Domain d5u6qa1: 5u6q A:1-178

Lineage for d5u6qa1 (5u6q A:1-178)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (99 PDB entries)

8. Domain d5u6qa1: 5u6q A:1-178 [329692]
   Other proteins in same PDB: d5u6qa2, d5u6qa3, d5u6qb1, d5u6qb2, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qd2, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_
   automated match to d4l4va1
   complexed with 7zs, act, gol, na

Details for d5u6qa1

PDB Entry: 5u6q, 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr

PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u6qa1:

Sequence, based on SEQRES records:

>d5u6qa1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records):

>d5u6qa1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d5u6qa1:

• d5u6qa1 first appeared in SCOPe 2.06