Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (2 families) |
Family d.177.1.0: automated matches [191367] (1 protein) not a true family |
Protein automated matches [190444] (4 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [329537] (1 PDB entry) |
Domain d5ti1f2: 5ti1 F:138-436 [329689] Other proteins in same PDB: d5ti1a1, d5ti1b1, d5ti1c1, d5ti1d1, d5ti1e1, d5ti1f1, d5ti1g1, d5ti1h1 automated match to d4qkud2 complexed with mg, na, no3, po4 |
PDB Entry: 5ti1 (more details), 2 Å
SCOPe Domain Sequences for d5ti1f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ti1f2 d.177.1.0 (F:138-436) automated matches {Burkholderia xenovorans [TaxId: 266265]} vqipgytdfysskehatnvgsmfrdpknallpnwsempigyngrassvvvsgtpvrrpng qlklpdqerpvfgacrkldieletgfvigagnalgepvtcadaeahifgmvllndwsard iqqweyvplgpfnaktfattispwivtldalepfrvaqpaqdpqplaylrhdgehafdit levtlrpqqakeastitrtnfkhmywtmaqqlahhtvsgcntrvgdlmgsgtisgpteds fgslleltwngkkplelreggtrsfiedgdeltlagwcqgegyrvgfgvcageilpalk
Timeline for d5ti1f2: