SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ti1f1 (5ti1 F:4-137)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047093Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) (S)
    automatically mapped to Pfam PF09298
  5. 2047107Family b.34.8.0: automated matches [257687] (1 protein)
    not a true family
  6. 2047108Protein automated matches [257688] (2 species)
    not a true protein
  7. 2286234Species Burkholderia xenovorans [TaxId:266265] [329535] (1 PDB entry)
  8. 2286387Domain d5ti1f1: 5ti1 F:4-137 [329688]
    Other proteins in same PDB: d5ti1a2, d5ti1b2, d5ti1c2, d5ti1d2, d5ti1e2, d5ti1f2, d5ti1g2, d5ti1h2
    automated match to d4qkua1
    complexed with mg, na, no3, po4

Details for d5ti1f1

PDB Entry: 5ti1 (more details), 2 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
PDB Compounds: (F:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d5ti1f1:

Sequence, based on SEQRES records: (download)

>d5ti1f1 b.34.8.0 (F:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpstgagdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrg
ralirqadaqlhlp

Sequence, based on observed residues (ATOM records): (download)

>d5ti1f1 b.34.8.0 (F:4-137) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ssdlqatldpsrkswvesannptgdfsiqnlpfgifsdglnatrrvgvaigdsivdlaal
esagllsvpsdsvfvrdalndfialgrdawrsvrvqlsrllsrddatlrddaelrgrali
rqadaqlhlp

SCOPe Domain Coordinates for d5ti1f1:

Click to download the PDB-style file with coordinates for d5ti1f1.
(The format of our PDB-style files is described here.)

Timeline for d5ti1f1:

  • d5ti1f1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09