Lineage for d5tsra_ (5tsr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116265Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains)
  6. 2116295Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2116300Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
    Uniprot O75365 1-162 # 99% sequence identity
  8. 2286379Domain d5tsra_: 5tsr A: [329680]
    automated match to d2mbca_

Details for d5tsra_

PDB Entry: 5tsr (more details), 3.19 Å

PDB Description: crystal structure of prl-3 phosphatase in complex with the bateman domain of cnnm3 magnesium transporter
PDB Compounds: (A:) Protein tyrosine phosphatase type IVA 3

SCOPe Domain Sequences for d5tsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tsra_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
nrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplekdgit
vvdwpfddgapppgkvvedwlslvkakfceapgscvavhavaglgrapvlvalaliesgm
kyedaiqfirqkrrgainskqltylekyrpkqrlr

SCOPe Domain Coordinates for d5tsra_:

Click to download the PDB-style file with coordinates for d5tsra_.
(The format of our PDB-style files is described here.)

Timeline for d5tsra_:

  • d5tsra_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from other chains:
(mouse over for more information)
d5tsrc_