SCOP 1.61: Domain d1gsfb2: 1gsf B:2-80

Lineage for d1gsfb2 (1gsf B:2-80)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)

8. Domain d1gsfb2: 1gsf B:2-80 [32968]
   Other proteins in same PDB: d1gsfa1, d1gsfb1

Details for d1gsfb2

PDB Entry: 1gsf, 2.7 Å

PDB Description: glutathione transferase a1-1 complexed with ethacrynic acid

SCOP Domain Sequences for d1gsfb2:

Sequence; same for both SEQRES and ATOM records:

>d1gsfb2 c.47.1.5 (B:2-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d1gsfb2:

• d1gsfb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gsfb2 appears in SCOP 1.59
  
• d1gsfb2 appears in SCOP 1.63
  
• d1gsfb2 appears in the current release, SCOPe 2.08