SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tsrc_ (5tsr C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116265Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 protein domains)
  6. 2116295Protein Protein tyrosine phosphatase type IVa [102418] (3 species)
  7. 2116300Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
    Uniprot O75365 1-162 # 99% sequence identity
  8. 2286376Domain d5tsrc_: 5tsr C: [329677]
    automated match to d2mbca_

Details for d5tsrc_

PDB Entry: 5tsr (more details), 3.19 Å

PDB Description: crystal structure of prl-3 phosphatase in complex with the bateman domain of cnnm3 magnesium transporter
PDB Compounds: (C:) Protein tyrosine phosphatase type IVA 3

SCOPe Domain Sequences for d5tsrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tsrc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
nrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplekdgit
vvdwpfddgapppgkvvedwlslvkakfceapgscvavhavaglgrapvlvalaliesgm
kyedaiqfirqkrrgainskqltylekyrpkqrl

SCOPe Domain Coordinates for d5tsrc_:

Click to download the PDB-style file with coordinates for d5tsrc_.
(The format of our PDB-style files is described here.)

Timeline for d5tsrc_:

  • d5tsrc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from other chains:
(mouse over for more information)
d5tsra_