Lineage for d5u72c2 (5u72 C:179-269)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (889 PDB entries)
  8. 2286370Domain d5u72c2: 5u72 C:179-269 [329671]
    Other proteins in same PDB: d5u72a1, d5u72a3, d5u72b2, d5u72c1, d5u72c3, d5u72d2, d5u72f_, d5u72h_
    automated match to d4l4va2
    complexed with 7zv, act, dms, gol

Details for d5u72c2

PDB Entry: 5u72 (more details), 2.5 Å

PDB Description: structure of human mr1-5oh-dcf in complex with human mait a-f7 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u72c2:

Sequence, based on SEQRES records: (download)

>d5u72c2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d5u72c2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeieidygdilpsgdgtyqa
wasieldsnlyschvehsgvhmvlqv

SCOPe Domain Coordinates for d5u72c2:

Click to download the PDB-style file with coordinates for d5u72c2.
(The format of our PDB-style files is described here.)

Timeline for d5u72c2:

  • d5u72c2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09