![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
![]() | Domain d5u72c1: 5u72 C:1-178 [329670] Other proteins in same PDB: d5u72a2, d5u72a3, d5u72b1, d5u72b2, d5u72c2, d5u72c3, d5u72d1, d5u72d2, d5u72e1, d5u72e2, d5u72f_, d5u72g1, d5u72g2, d5u72h_ automated match to d4l4va1 complexed with 7zv, act, dms, gol |
PDB Entry: 5u72 (more details), 2.5 Å
SCOPe Domain Sequences for d5u72c1:
Sequence, based on SEQRES records: (download)
>d5u72c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
>d5u72c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u72c1: