Lineage for d5u72c1 (5u72 C:1-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (67 PDB entries)
  8. 2507628Domain d5u72c1: 5u72 C:1-178 [329670]
    Other proteins in same PDB: d5u72a2, d5u72a3, d5u72b1, d5u72b2, d5u72c2, d5u72c3, d5u72d1, d5u72d2, d5u72e1, d5u72e2, d5u72f_, d5u72g1, d5u72g2, d5u72h_
    automated match to d4l4va1
    complexed with 7zv, act, dms, gol

Details for d5u72c1

PDB Entry: 5u72 (more details), 2.5 Å

PDB Description: structure of human mr1-5oh-dcf in complex with human mait a-f7 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u72c1:

Sequence, based on SEQRES records: (download)

>d5u72c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Sequence, based on observed residues (ATOM records): (download)

>d5u72c1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpivpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwery
tqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdflif
nkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u72c1:

Click to download the PDB-style file with coordinates for d5u72c1.
(The format of our PDB-style files is described here.)

Timeline for d5u72c1: