Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316254] (14 PDB entries) |
Domain d5tr2a2: 5tr2 A:192-304 [329664] Other proteins in same PDB: d5tr2a4, d5tr2a5, d5tr2b4 automated match to d5f9ca2 complexed with ca, gol, so4 |
PDB Entry: 5tr2 (more details), 2.5 Å
SCOPe Domain Sequences for d5tr2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tr2a2 c.84.1.0 (A:192-304) automated matches {Human (Homo sapiens) [TaxId: 9606]} veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc vpledfgghhpgpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d5tr2a2:
View in 3D Domains from same chain: (mouse over for more information) d5tr2a1, d5tr2a3, d5tr2a4, d5tr2a5 |
View in 3D Domains from other chains: (mouse over for more information) d5tr2b1, d5tr2b2, d5tr2b3, d5tr2b4 |