Lineage for d5tr2a1 (5tr2 A:1-191)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483048Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2483049Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2483141Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2483142Protein automated matches [254721] (3 species)
    not a true protein
  7. 2483143Species Human (Homo sapiens) [TaxId:9606] [316254] (10 PDB entries)
  8. 2483162Domain d5tr2a1: 5tr2 A:1-191 [329663]
    Other proteins in same PDB: d5tr2a4, d5tr2a5, d5tr2b4
    automated match to d5hshb1
    complexed with ca, gol, so4

Details for d5tr2a1

PDB Entry: 5tr2 (more details), 2.5 Å

PDB Description: crystal structure of the d263g missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5tr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr2a1 c.84.1.0 (A:1-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
fkpftveivds

SCOPe Domain Coordinates for d5tr2a1:

Click to download the PDB-style file with coordinates for d5tr2a1.
(The format of our PDB-style files is described here.)

Timeline for d5tr2a1: