SCOPe 2.06: Domain d5tr2a1: 5tr2 A:1-191

SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tr2a1 (5tr2 A:1-191)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
consists of three similar domains with 3 layers (a/b/a) each; duplication
core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)
Family c.84.1.0: automated matches [254314] (1 protein)
not a true family
Protein automated matches [254721] (3 species)
not a true protein
Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries)
Domain d5tr2a1: 5tr2 A:1-191 [329663]
Other proteins in same PDB: d5tr2a4, d5tr2a5, d5tr2b4
automated match to d5hshb1
complexed with ca, gol, so4

Details for d5tr2a1

PDB Entry: 5tr2 (more details), 2.5 Å

PDB Description: crystal structure of the d263g missense variant of human pgm1

PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5tr2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr2a1 c.84.1.0 (A:1-191) automated matches {Homo sapiens [TaxId: 9606]}
mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
fkpftveivds

SCOPe Domain Coordinates for d5tr2a1:

Click to download the PDB-style file with coordinates for d5tr2a1.
(The format of our PDB-style files is described here.)

Timeline for d5tr2a1: