Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
Protein Glutathione S-transferase [52863] (27 species) |
Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries) |
Domain d1guhb2: 1guh B:2-80 [32966] Other proteins in same PDB: d1guha1, d1guhb1 |
PDB Entry: 1guh (more details), 2.6 Å
SCOP Domain Sequences for d1guhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guhb2 c.47.1.5 (B:2-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)} aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d1guhb2: