Lineage for d1guhb2 (1guh B:2-80)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123346Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries)
  8. 123352Domain d1guhb2: 1guh B:2-80 [32966]
    Other proteins in same PDB: d1guha1, d1guhb1

Details for d1guhb2

PDB Entry: 1guh (more details), 2.6 Å

PDB Description: Structure determination and refinement of human alpha class glutathione transferase A1-1, and a comparison with the MU and PI class enzymes

SCOP Domain Sequences for d1guhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guhb2 c.47.1.5 (B:2-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOP Domain Coordinates for d1guhb2:

Click to download the PDB-style file with coordinates for d1guhb2.
(The format of our PDB-style files is described here.)

Timeline for d1guhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guhb1