Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d5u2vd_: 5u2v D: [329652] Other proteins in same PDB: d5u2va1, d5u2va2, d5u2va3, d5u2vc1, d5u2vc2, d5u2vc3, d5u2ve1, d5u2ve2, d5u2vf1, d5u2vf2, d5u2vg1, d5u2vg2, d5u2vh1, d5u2vh2 automated match to d1xh3b_ complexed with 7wq, gol, pro |
PDB Entry: 5u2v (more details), 2.2 Å
SCOPe Domain Sequences for d5u2vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u2vd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwd
Timeline for d5u2vd_: