SCOPe 2.06: Domain d5u6qd2: 5u6q D:111-200

Lineage for d5u6qd2 (5u6q D:111-200)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (16 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

Domain d5u6qd2: 5u6q D:111-200 [329651]
Other proteins in same PDB: d5u6qa1, d5u6qa2, d5u6qa3, d5u6qb1, d5u6qb2, d5u6qc1, d5u6qc2, d5u6qc3, d5u6qd1, d5u6qe1, d5u6qe2, d5u6qf_, d5u6qg1, d5u6qg2, d5u6qh_
automated match to d2f54d2
complexed with 7zs, act, gol, na

Details for d5u6qd2

PDB Entry: 5u6q (more details), 1.9 Å

PDB Description: structure of human mr1-3-f-sa in complex with human mait a-f7 tcr

PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u6qd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u6qd2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5u6qd2:

Click to download the PDB-style file with coordinates for d5u6qd2.
(The format of our PDB-style files is described here.)

Timeline for d5u6qd2: